Description
PeptideLabsDirect Tesamorelin & Ipamorelin Blend (8mg)
Precision Research Compound for Growth Hormone Secretion & Metabolic Study
Look, you’re here because you know what these compounds can do. You’ve read the studies, you understand the mechanisms. This isn’t a magic potion; it’s a sophisticated, synergistic research blend. At PeptideLabsDirect, we provide the exact, high-purity materials you need for your work. This 8mg blend of Tesamorelin and Ipamorelin is for the researcher who wants to target the pituitary’s GH release pathways from two distinct angles. We’ll give you the straight facts, no hype.
The Synergy: How This Blend Works
Think of it as a coordinated approach. Tesamorelin is a synthetic analog of Growth Hormone-Releasing Hormone (GHRH). It binds to the GHRH receptors on pituitary cells, initiating a signaling cascade (primarily the cAMP-PKA pathway) that tells the cell to synthesize and release growth hormone. It’s a direct, potent signal.
Ipamorelin works differently. It’s a selective growth hormone secretagogue (GHS) that binds to ghrelin receptors (GHS-R). This activation triggers a separate intracellular pathway (involving PLC, IP3, and calcium release) that prompts the immediate secretion of stored growth hormone.
The result in research models is a significant, pulsatile increase in GH levels—Tesamorelin driving new hormone production and Ipamorelin ensuring its efficient release. This dual-pathway action is why this blend is a subject of interest for studying body composition, metabolic function, and tissue repair.
Key Research Applications & Findings
This is where the data gets interesting. We don’t deal in anecdotes; we look at what the controlled studies suggest.
Visceral Fat & Metabolism
Research on Tesamorelin points to a specific action on visceral adipose tissue. In models of lipodystrophy (abnormal fat distribution), it’s been associated with a reduction of visceral fat mass by approximately 25%. This isn’t general weight loss; it’s a targeted reduction of the metabolically active fat surrounding organs, which is linked to improvements in insulin sensitivity and lipid profiles. Ipamorelin, while increasing GH, may stimulate appetite via ghrelin receptor activity. The blend allows for study of the balance between these effects.
Muscle Tissue Quality & Nitrogen Balance
Studies using imaging like CT scans have noted that Tesamorelin exposure is correlated with improvements in muscle density and area, particularly in core muscular structures (psoas, abdominals, paraspinals). This suggests a potential for reducing intramuscular fat infiltration. Separately, research on Ipamorelin under catabolic stress indicates it may help restore positive nitrogen balance and reduce excessive urea synthesis, pointing to a potential role in preserving lean mass. The blend is therefore relevant for musculoskeletal research.
Bone & Digestive Function
Preliminary animal studies on Ipamorelin suggest it may stimulate bone formation and increase bone mass, primarily through increased bone dimensions. On a different front, its action on ghrelin receptors appears to influence gastric motility, with studies showing it may accelerate gastric emptying rates compared to controls. This opens avenues for research into digestive efficiency.
Specifications & Handling
You need to know what you’re working with. Here are the specs.
- Blend: Tesamorelin Acetate / Ipamorelin
- Total Quantity: 8mg (lyophilized powder)
- Purity: >99% (HPLC verified)
- Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys-NH2
- Molecular Formula (Tesamorelin): C221H366N72O67S
- Molecular Formula (Ipamorelin): C38H49N9O5
Storage: Store in a cool, dry place (recommended -20°C for long-term stability). Reconstitute with sterile bacteriostatic water for research purposes. Follow proper laboratory sterile technique.
Why Source From PeptideLabsDirect?
We’re not a faceless distributor. We cater to serious researchers. Every batch of this blend is independently third-party tested for purity, potency, and sterility. The data sheet is in the box. We use mass spectrometry (MS) and high-performance liquid chromatography (HPLC) to confirm what’s on the label is what’s in the vial. Our packaging is discrete, secure, and includes desiccant for stability. Orders placed before 12 PM PST ship same day.
CRITICAL LEGAL NOTICE
This product is sold as a research chemical ONLY. It is intended for in-vitro laboratory research use in controlled settings. It is NOT for human or animal consumption, diagnostic use, or therapeutic application. It is NOT a dietary supplement, drug, or cosmetic. Handling should only be performed by qualified, licensed professionals in a legitimate research facility. By purchasing this product, you acknowledge and certify that you are familiar with the legal status of this material in your jurisdiction and will adhere to all applicable laws and regulations. All information presented here is for educational and scientific discussion purposes.
Price: $99.00
Ready to order? Add to cart. Have a technical question about the blend or its applications? Contact us directly. We know this stuff.






Reviews
There are no reviews yet.